PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc005236.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family FAR1
Protein Properties Length: 230aa    MW: 25592.9 Da    PI: 9.7167
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc005236.1_g00001.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR146.71e-14106172270
                     FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkk 70 
                               Y++YA++vGFsvrksk++++  +++++++tf Csk g++ +e++    +  ++   rtgC a +++  
  Itr_sc005236.1_g00001.1 106 LYKDYAYRVGFSVRKSKQRYQGSTNNVKMKTFFCSKDGYKCKENSG--VKAYSKIDLRTGCGAFVQIDV 172
                              7********************99*****************999877..8889999**********9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031015.3E-11106172IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MLVKVTRGKH NNKENKKERK QKRKICGVVG GGRSCDGDRG GRRAKANVEG GQNRQLKAPL  60
ELRPEADDVG AHVMLLRKID HSLGLYNVDQ DLVGIVVSNA DEAYKLYKDY AYRVGFSVRK  120
SKQRYQGSTN NVKMKTFFCS KDGYKCKENS GVKAYSKIDL RTGCGAFVQI DVDGGSPLVG  180
FTNRDAYNSL TFGSLKSLDG TDSNSLIEIF RRMQCNVSDF FFDFEVDGDG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015574673.17e-23PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14143211
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18960.19e-08FAR1-related sequence 12